(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE69

CP000124.PE69        Location/Qualifiers
FT   CDS             78745..81768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50236"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY61"
FT                   /protein_id="ABA50236.1"
FT                   /translation="MRCVRRARLCAERLDQRHLLARHQLLDVHQDQHPAVDRAEARQVL
FT                   GRQHAAEFRRGHDLLGRQREHVGHAVDDHPDDAVRDVQDDHDRLMVVLDAAEVELDPHV
FT                   DDRHDDAAQVDHALDEIGRVRDPRDAVVAADFLYFQNVDAVFLVAEREDEKLLARGVAL
FT                   FGVAAAGRVRRGRMIRLDFGHVSPLIDGSRKLGRGERGARMRAVRRAGLAIERRDVDDQ
FT                   RDAAVAENRRGRNAVHLAVVRLEVLDDHLLLAHQLVDQHREAAAFRLHDRDDALRRIGA
FT                   RVVHREHLVQRDERQVLAAHAHDALAVADRVDVVGRGLQRLHHEVQRQDEDLVADLHRH
FT                   PVENRERERQHDARRRAAAGLRRNLDVPAHRLDVALDDVHPDAAARHVGHDFGGREARR
FT                   EDQVPHFVVADVLGDLHPLLGRLREDPLAVQARAVVADLDHDVAAVVRGRQHELADRVL
FT                   ARRAARLDGLDAVIEAVAHEVRQRIDDPFDEALVELGRLAERDELDLLAELAREIAHEP
FT                   RKAAEHVIHRHHPDRHHGFLQIARVALELRHPVVQAVVQRRIERARRLGEHRLRDHELA
FT                   DQVDQLVDLLDADANRAALRARGGGRARLAIVLVLRGGGRRGLRGRRRGGCGRARRGGR
FT                   RGRARVGDGRRRRLRRGRFRRGLLGSGFGRGFARLPRRRRGLRVARARRGAAADRDLAF
FT                   VDHEAAHGDDVVRRHVGLEPQRECVARLRAADDPAEIAELLGQQFLILVVDARERDLQM
FT                   RAIAAGRGLGRAGHRMRGLDRLLDDVLGRAEEAHRGRGRRSRRRRHGLSRRNGRRRRGG
FT                   SSGRSGRGRGCRRRLRAARRRLQPLELRADRGRGGRIGLGARAVVGELVGQHVLRLEER
FT                   IDHLLRQRELMIACAIEQRFEDVRRFRERGEAERRGAALDRVRGAKDRRQILGIGRGDV
FT                   QVQQQLLHLREQLVGFVEERLVELCDIESHAGSPPKNVVFVTKGSTTPKAPRRARSARP
FT                   GRSAFRSSRSRPPRAPHP"
     MRCVRRARLC AERLDQRHLL ARHQLLDVHQ DQHPAVDRAE ARQVLGRQHA AEFRRGHDLL        60
     GRQREHVGHA VDDHPDDAVR DVQDDHDRLM VVLDAAEVEL DPHVDDRHDD AAQVDHALDE       120
     IGRVRDPRDA VVAADFLYFQ NVDAVFLVAE REDEKLLARG VALFGVAAAG RVRRGRMIRL       180
     DFGHVSPLID GSRKLGRGER GARMRAVRRA GLAIERRDVD DQRDAAVAEN RRGRNAVHLA       240
     VVRLEVLDDH LLLAHQLVDQ HREAAAFRLH DRDDALRRIG ARVVHREHLV QRDERQVLAA       300
     HAHDALAVAD RVDVVGRGLQ RLHHEVQRQD EDLVADLHRH PVENRERERQ HDARRRAAAG       360
     LRRNLDVPAH RLDVALDDVH PDAAARHVGH DFGGREARRE DQVPHFVVAD VLGDLHPLLG       420
     RLREDPLAVQ ARAVVADLDH DVAAVVRGRQ HELADRVLAR RAARLDGLDA VIEAVAHEVR       480
     QRIDDPFDEA LVELGRLAER DELDLLAELA REIAHEPRKA AEHVIHRHHP DRHHGFLQIA       540
     RVALELRHPV VQAVVQRRIE RARRLGEHRL RDHELADQVD QLVDLLDADA NRAALRARGG       600
     GRARLAIVLV LRGGGRRGLR GRRRGGCGRA RRGGRRGRAR VGDGRRRRLR RGRFRRGLLG       660
     SGFGRGFARL PRRRRGLRVA RARRGAAADR DLAFVDHEAA HGDDVVRRHV GLEPQRECVA       720
     RLRAADDPAE IAELLGQQFL ILVVDARERD LQMRAIAAGR GLGRAGHRMR GLDRLLDDVL       780
     GRAEEAHRGR GRRSRRRRHG LSRRNGRRRR GGSSGRSGRG RGCRRRLRAA RRRLQPLELR       840
     ADRGRGGRIG LGARAVVGEL VGQHVLRLEE RIDHLLRQRE LMIACAIEQR FEDVRRFRER       900
     GEAERRGAAL DRVRGAKDRR QILGIGRGDV QVQQQLLHLR EQLVGFVEER LVELCDIESH       960
     AGSPPKNVVF VTKGSTTPKA PRRARSARPG RSAFRSSRSR PPRAPHP                    1007
//

If you have problems or comments...

PBIL Back to PBIL home page