(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE7

CP000124.PE7         Location/Qualifiers
FT   CDS             12373..13203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47676"
FT                   /db_xref="InterPro:IPR014973"
FT                   /db_xref="InterPro:IPR022123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC3"
FT                   /protein_id="ABA47676.1"
FT                   /translation="MSTIHVTMGGSAAASLRIALADAGRDEGVVELFDDLSVGPLRGAD
FT                   DSPDVRAAFWERAIGDVQQDWTAGLGGDFAKLETLAADTGQVVVWHAQSVADQLMLRRV
FT                   AYHLRNAPQRLNEVRLSSADIDDPQSWVRLRADQATATGIFSSAQLRAKLPEAAPISVL
FT                   RISRLALEWQEAKQANAELRYWICNTFKSGHYADIDALVLEHAPDEWGPAARTIGAVMA
FT                   FADRGHLFVGDVIAFWRCRELAAAGRIELQGDARSIDDLRTATLRATPAVALPR"
     MSTIHVTMGG SAAASLRIAL ADAGRDEGVV ELFDDLSVGP LRGADDSPDV RAAFWERAIG        60
     DVQQDWTAGL GGDFAKLETL AADTGQVVVW HAQSVADQLM LRRVAYHLRN APQRLNEVRL       120
     SSADIDDPQS WVRLRADQAT ATGIFSSAQL RAKLPEAAPI SVLRISRLAL EWQEAKQANA       180
     ELRYWICNTF KSGHYADIDA LVLEHAPDEW GPAARTIGAV MAFADRGHLF VGDVIAFWRC       240
     RELAAAGRIE LQGDARSIDD LRTATLRATP AVALPR                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page