(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE81

CP000124.PE81        Location/Qualifiers
FT   CDS             complement(89321..90211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0087"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family superfamily"
FT                   /note="identified by match to protein family HMM PF01869"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47871"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY49"
FT                   /protein_id="ABA47871.1"
FT                   /translation="MGNDIFLIGIDGGGTGTRAVLADARGRELAQGSAGPSGLALGIEA
FT                   AWRSIEAASAEACARAGVAFDWRHCVLGCGLAGVNHRAWLNAFRASAPLAALAIESDAY
FT                   TTVVGAHGGAPGVIVALGTGSIAAALDASGACRIAGGYGFPSGDEASGAWLGLRALSYA
FT                   QQALDGRAPLDALARALVAHTGAPDRDALIVWSCEANQTAYAQLAPIVLAHRDHPAAAH
FT                   WIEQAGIEIGRMIDALDPAAALPVALCGGLAQALASAVPEPHGARLVAPQADSAHGALR
FT                   LAEREAARLGLTAPR"
     MGNDIFLIGI DGGGTGTRAV LADARGRELA QGSAGPSGLA LGIEAAWRSI EAASAEACAR        60
     AGVAFDWRHC VLGCGLAGVN HRAWLNAFRA SAPLAALAIE SDAYTTVVGA HGGAPGVIVA       120
     LGTGSIAAAL DASGACRIAG GYGFPSGDEA SGAWLGLRAL SYAQQALDGR APLDALARAL       180
     VAHTGAPDRD ALIVWSCEAN QTAYAQLAPI VLAHRDHPAA AHWIEQAGIE IGRMIDALDP       240
     AAALPVALCG GLAQALASAV PEPHGARLVA PQADSAHGAL RLAEREAARL GLTAPR           296
//

If you have problems or comments...

PBIL Back to PBIL home page