(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE85

CP000124.PE85        Location/Qualifiers
FT   CDS             93337..95010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50732"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY45"
FT                   /protein_id="ABA50732.1"
FT                   /translation="MRRSNTLVAAARFCFLILPNSAKFAGRLRRRREPPDVHARHQHDA
FT                   AANQLGAAASSAVDHQRLDGQFVDGRQLARHRARQREDGRPERGAVDFDRDRPDDAFRA
FT                   RHAEGRAHRAASGDRLAQRRHADPEIHRHGNGHRAHRDDGRGCGGRQLLGRRHADRHVA
FT                   DAVFRRIQCDAAARHRHADAERRRQIDVDLDRFDEQHAFRHRRRDQLRVEQPRRDGDDR
FT                   HGHRRRAPRAALGKHGRGQRDQRRREQPVRRQRAVEPRRHVDGEHDGRPVDDPLGRQRR
FT                   MDAKHLRSGRRIHGGRHRRVEREQRSVGCDRRRHAEPHASRRRRHADAERDHRHHRAGH
FT                   RDHERRQPVQHGDHDDVVAVVAIRRGHQLAKRGAAPRRLHAQHDPQLARARGGRGRDDG
FT                   RLDHVARVDRHQVRRRLVVVADGRRTDHRYGQAQRRAAKQPVDRRRALQFDERHRRAAE
FT                   HHDPELCADGRRLRYALERAEPGPEEPRAAADAARVVRVATHVAIQRAVHRAQHADGAD
FT                   EQQLELPDAAVRRQQQLGRDGEQQVTNRTRWRSLKWIRCR"
     MRRSNTLVAA ARFCFLILPN SAKFAGRLRR RREPPDVHAR HQHDAAANQL GAAASSAVDH        60
     QRLDGQFVDG RQLARHRARQ REDGRPERGA VDFDRDRPDD AFRARHAEGR AHRAASGDRL       120
     AQRRHADPEI HRHGNGHRAH RDDGRGCGGR QLLGRRHADR HVADAVFRRI QCDAAARHRH       180
     ADAERRRQID VDLDRFDEQH AFRHRRRDQL RVEQPRRDGD DRHGHRRRAP RAALGKHGRG       240
     QRDQRRREQP VRRQRAVEPR RHVDGEHDGR PVDDPLGRQR RMDAKHLRSG RRIHGGRHRR       300
     VEREQRSVGC DRRRHAEPHA SRRRRHADAE RDHRHHRAGH RDHERRQPVQ HGDHDDVVAV       360
     VAIRRGHQLA KRGAAPRRLH AQHDPQLARA RGGRGRDDGR LDHVARVDRH QVRRRLVVVA       420
     DGRRTDHRYG QAQRRAAKQP VDRRRALQFD ERHRRAAEHH DPELCADGRR LRYALERAEP       480
     GPEEPRAAAD AARVVRVATH VAIQRAVHRA QHADGADEQQ LELPDAAVRR QQQLGRDGEQ       540
     QVTNRTRWRS LKWIRCR                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page