(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE87

CP000124.PE87        Location/Qualifiers
FT   CDS             94977..95291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49005"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY43"
FT                   /protein_id="ABA49005.1"
FT                   /translation="MEKPEMDQMSLIEHVLSITREIDHAVQMADWTEAVRLTEERSPYL
FT                   MSITAEQTPASLALVRQLQAIDTALLANAKAAQAELQVEYRTAMDRLSQAGAYQAAAQL
FT                   "
     MEKPEMDQMS LIEHVLSITR EIDHAVQMAD WTEAVRLTEE RSPYLMSITA EQTPASLALV        60
     RQLQAIDTAL LANAKAAQAE LQVEYRTAMD RLSQAGAYQA AAQL                        104
//

If you have problems or comments...

PBIL Back to PBIL home page