(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE95

CP000124.PE95        Location/Qualifiers
FT   CDS             102081..102713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0101"
FT                   /product="hexapeptide transferase family protein"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48789"
FT                   /db_xref="GOA:Q3JY35"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY35"
FT                   /protein_id="ABA48789.1"
FT                   /translation="MTPRLIVAGCGAFARELINWADDAAHAGIGQRITGFLDANPAALA
FT                   GFPYRAEWLGDIDAYTPEDGDELIVAIGDPNAKRDVVERLRARGARFGSLRHPSAVVAR
FT                   SASLGAGVVLCPHAVVSADAQIGDFVAVNVLSSIGHDVKIGAYSTLSSHVDLMGHVETG
FT                   ERVFFGSGAKILPKVRIGAGAKIGAGATVMRSAPENAVLYTMPAKKL"
     MTPRLIVAGC GAFARELINW ADDAAHAGIG QRITGFLDAN PAALAGFPYR AEWLGDIDAY        60
     TPEDGDELIV AIGDPNAKRD VVERLRARGA RFGSLRHPSA VVARSASLGA GVVLCPHAVV       120
     SADAQIGDFV AVNVLSSIGH DVKIGAYSTL SSHVDLMGHV ETGERVFFGS GAKILPKVRI       180
     GAGAKIGAGA TVMRSAPENA VLYTMPAKKL                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page