(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE96

CP000124.PE96        Location/Qualifiers
FT   CDS             102715..103779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0102"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51166"
FT                   /db_xref="GOA:Q3JY34"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY34"
FT                   /protein_id="ABA51166.1"
FT                   /translation="MNFDTDLLHRHWHLGCHRRELPNDGDFVRFDTAIGEIVIFNDAGE
FT                   LVAFDNRCPHRGARMYVDDSGNQPASCPYHGWTYREGRLLIPGRERFDGCALERAKLRT
FT                   FAVDWCGDFLFFAVHPQTDLYTQLGRFAEAVENISFNIDRRLDLNRYDFECYWPLAIEN
FT                   ALEPYHIGAVHPQTLATLGLEDGENVFDGVNCAWYAPVGASRQRNQLARLKRFFNLDYQ
FT                   YEGYASIYLFPFTMISSTYGYSYSLQHFLPAGVGGDRTRFTSRLYAAPAASEQAAQALG
FT                   AFFESTRDVNRRVFEEDHAICKRMPRNAWSMAPLACAADTEAKIDHFRRACRTFAASRA
FT                   ALPVVDATREAAAG"
     MNFDTDLLHR HWHLGCHRRE LPNDGDFVRF DTAIGEIVIF NDAGELVAFD NRCPHRGARM        60
     YVDDSGNQPA SCPYHGWTYR EGRLLIPGRE RFDGCALERA KLRTFAVDWC GDFLFFAVHP       120
     QTDLYTQLGR FAEAVENISF NIDRRLDLNR YDFECYWPLA IENALEPYHI GAVHPQTLAT       180
     LGLEDGENVF DGVNCAWYAP VGASRQRNQL ARLKRFFNLD YQYEGYASIY LFPFTMISST       240
     YGYSYSLQHF LPAGVGGDRT RFTSRLYAAP AASEQAAQAL GAFFESTRDV NRRVFEEDHA       300
     ICKRMPRNAW SMAPLACAAD TEAKIDHFRR ACRTFAASRA ALPVVDATRE AAAG             354
//

If you have problems or comments...

PBIL Back to PBIL home page