(data stored in SCRATCH9089 zone)

EMBL: CP000124.PHEC

CP000124.PHEC        Location/Qualifiers
FT   CDS             178261..179046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheC"
FT                   /locus_tag="BURPS1710b_0172"
FT                   /product="cyclohexadienyl dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50393"
FT                   /db_xref="GOA:Q3JXW5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR037298"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW5"
FT                   /protein_id="ABA50393.1"
FT                   /translation="MKMNQTLLALACCAGLAHAQTAPQPGAPASRLDDVLARGTLRVCT
FT                   TGDYKPYTYRREDGAFEGIDIDMAASLAKSLGVKTAFVKTTWPTLTDDFVAKCDIAVGG
FT                   ISTTLERQKRVFFTQPYVSDGKTPIVRCADAERYQTIAQIDQPQTRVIVNPGGTNERFA
FT                   KQHFTRAKLTVFPDNVTIFKQILAGNADVMVTDASETLLQQKLNPGLCSVHPDKPFQFG
FT                   EKAYMVPRGDVVFQQYVDQWLHLARETGELRAISDKWLK"
     MKMNQTLLAL ACCAGLAHAQ TAPQPGAPAS RLDDVLARGT LRVCTTGDYK PYTYRREDGA        60
     FEGIDIDMAA SLAKSLGVKT AFVKTTWPTL TDDFVAKCDI AVGGISTTLE RQKRVFFTQP       120
     YVSDGKTPIV RCADAERYQT IAQIDQPQTR VIVNPGGTNE RFAKQHFTRA KLTVFPDNVT       180
     IFKQILAGNA DVMVTDASET LLQQKLNPGL CSVHPDKPFQ FGEKAYMVPR GDVVFQQYVD       240
     QWLHLARETG ELRAISDKWL K                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page