(data stored in SCRATCH9089 zone)

EMBL: CP000124.PHOA2

CP000124.PHOA2       Location/Qualifiers
FT   CDS             580626..582029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA2"
FT                   /locus_tag="BURPS1710b_0568"
FT                   /product="alkaline phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49523"
FT                   /db_xref="GOA:Q3JWS1"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS1"
FT                   /protein_id="ABA49523.1"
FT                   /translation="MSTIKRIAAAAFAAAALSGGFGHAAHAAGQAKNVIFFLGDGMGPA
FT                   TVTASRLYKVGEAGQLTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSM
FT                   SPDTRAIAPGSDANGNKTVNRCGVGNGTPAATLLELAKARGKAVGAITTTELTHATPAA
FT                   TYSHICHRDAQYDIAVQAVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPLANRRGRADG
FT                   RNLLAELQAKGYAVVATKDQLAQAGAGKLIGLFSTTSHLEYELDRVAGKGEGATQPSLA
FT                   EMTAKAIDVLRKNPNGYFLMVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLS
FT                   DTLIVVTADHDHTMTINGYSKRGNPVLDISRNYRDGQPNKDADGNPYTTLVFGNGANRP
FT                   NVRVPVDSSTATNDAYLQEVGVRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVF
FT                   GLVKAAFGF"
     MSTIKRIAAA AFAAAALSGG FGHAAHAAGQ AKNVIFFLGD GMGPATVTAS RLYKVGEAGQ        60
     LTMEKLPRTA RIKTFSNDAQ TTDSAPSMAA YMTGVKMNNE VLSMSPDTRA IAPGSDANGN       120
     KTVNRCGVGN GTPAATLLEL AKARGKAVGA ITTTELTHAT PAATYSHICH RDAQYDIAVQ       180
     AVPGGAGYNA ALGDGVDVLM GGGRNHWTPY DPLANRRGRA DGRNLLAELQ AKGYAVVATK       240
     DQLAQAGAGK LIGLFSTTSH LEYELDRVAG KGEGATQPSL AEMTAKAIDV LRKNPNGYFL       300
     MVEGGRIDHA LHGTNAKRAL EDTVAFDEAI RTALAKVDLS DTLIVVTADH DHTMTINGYS       360
     KRGNPVLDIS RNYRDGQPNK DADGNPYTTL VFGNGANRPN VRVPVDSSTA TNDAYLQEVG       420
     VRMGSAGSET HGGGDVMLFA DGAGAKAFKG TLDNTKVFGL VKAAFGF                     467
//

If you have problems or comments...

PBIL Back to PBIL home page