(data stored in SCRATCH9089 zone)

EMBL: CP000124.PRIA

CP000124.PRIA        Location/Qualifiers
FT   CDS             complement(174319..176586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="BURPS1710b_0169"
FT                   /product="primosomal protein n`"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851; match to protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49872"
FT                   /db_xref="GOA:Q3JXW8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW8"
FT                   /protein_id="ABA49872.1"
FT                   /translation="MADAFVRVALDHPLPTLFDYRYRGDMPEAPGMLVQVPFGRRSVVG
FT                   LVCEVTAHTDVPAAKLKAVDAVCTELPPLSRHWLELAAFAADYYQRGLGEVALPALPQA
FT                   LRDVPRWGRLLAPELRYRLLDAGRAALPDALPARGAALRRLAQALADAPALSLAEVRAL
FT                   HPKAVAVLDEWQAQGWAACDEIAITHADAQLVDNPAPASAWRPTALPPQLTDQQAEALD
FT                   AIAAADGFAPFLLHGVTGSGKTEVYLRALAALLERRPEAQALVLVPEINLTPQFEAAFR
FT                   ARFAATLPADAIVTLHSGLAEGERARHWLAAHTGRARIVLGTRLAVLASLPALAMIVVD
FT                   EEHEPAYKQQEGLRYSARDLAVWRAKQLAIPVVLGSATPSLETWWQAEQGRYRRLTLTK
FT                   RAVADAALPTVRLVDLEEERRRGRGSMGGLSGPLVAALKARLERGEQSLVFLNRRGYAP
FT                   ALACDACGWVAGCPRCSAYVVMHKPEHAVRCHHCGWEARIPRACPECGNVDIAPLGRGT
FT                   QRVEETLALAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDFQR
FT                   VSLVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVLIQTRYPRHALYHAL
FT                   ARQDYVGFAGATLGERRDAHLPPFVYQALLRAEGRTLDAALAFLQQAADAFSGLPGAER
FT                   VTVYDAVPMTIVKVANVHRAQLLIESASRAALQHTLRAWQPLLRELKGVLRWSVEVDPL
FT                   DI"
     MADAFVRVAL DHPLPTLFDY RYRGDMPEAP GMLVQVPFGR RSVVGLVCEV TAHTDVPAAK        60
     LKAVDAVCTE LPPLSRHWLE LAAFAADYYQ RGLGEVALPA LPQALRDVPR WGRLLAPELR       120
     YRLLDAGRAA LPDALPARGA ALRRLAQALA DAPALSLAEV RALHPKAVAV LDEWQAQGWA       180
     ACDEIAITHA DAQLVDNPAP ASAWRPTALP PQLTDQQAEA LDAIAAADGF APFLLHGVTG       240
     SGKTEVYLRA LAALLERRPE AQALVLVPEI NLTPQFEAAF RARFAATLPA DAIVTLHSGL       300
     AEGERARHWL AAHTGRARIV LGTRLAVLAS LPALAMIVVD EEHEPAYKQQ EGLRYSARDL       360
     AVWRAKQLAI PVVLGSATPS LETWWQAEQG RYRRLTLTKR AVADAALPTV RLVDLEEERR       420
     RGRGSMGGLS GPLVAALKAR LERGEQSLVF LNRRGYAPAL ACDACGWVAG CPRCSAYVVM       480
     HKPEHAVRCH HCGWEARIPR ACPECGNVDI APLGRGTQRV EETLALAVPG ARILRIDADS       540
     TRRKGSAQAL FSDVHAGEVD ILVGTQMIAK GHDFQRVSLV GVLNADTALF SHDFRASERL       600
     FAQLMQVSGR AGRAGLPGEV LIQTRYPRHA LYHALARQDY VGFAGATLGE RRDAHLPPFV       660
     YQALLRAEGR TLDAALAFLQ QAADAFSGLP GAERVTVYDA VPMTIVKVAN VHRAQLLIES       720
     ASRAALQHTL RAWQPLLREL KGVLRWSVEV DPLDI                                  755
//

If you have problems or comments...

PBIL Back to PBIL home page