(data stored in SCRATCH9089 zone)

EMBL: CP000124.PUTA

CP000124.PUTA        Location/Qualifiers
FT   CDS             complement(169925..173854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="BURPS1710b_0166"
FT                   /product="proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM PF01619; match to protein
FT                   family HMM TIGR01238"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48352"
FT                   /db_xref="GOA:Q3JXX1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX1"
FT                   /protein_id="ABA48352.1"
FT                   /translation="MASTTLGVKVDDLLRARLKDAASRLERTPHWLIKQAIFAYLERIE
FT                   HGQLPPELSGHTGVADLSDSHADGDDDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEP
FT                   ECVPFLIGEARLPASLASDVQAMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMC
FT                   LAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEA
FT                   GLSSALTRLIGKGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYD
FT                   MLGEAATTEEDALRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQER
FT                   TMNELLPRVRSLALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVV
FT                   QAYQKRCPFVIDYLVDLARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYT
FT                   DVSYLACAKKLLAAPDAVYPQFATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLY
FT                   EEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKTVSVKELVAD
FT                   PVEDALKVVPLGAPHAKIALPRELYGASRVNSMGLDLSNEHRLASLSSALLASAHHPWR
FT                   AAPMLADDALAHAAPRDVRNPADLRDVVGTVSEATPDEVSAALAHAVAAAPIWQATPVD
FT                   ARADCLARAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSN
FT                   DTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLRDAG
FT                   VPAGAVQLLPGNGETVGAALVADPRTRAVMFTGSTEVARLINKTLSSRLDPDGRPIPLI
FT                   AETGGQNAMIVDSSALAEQVVADVLQSSFDSAGQRCSALRVLCLQDDVADRTLTMLKGA
FT                   MRELALGNPDRLSVDVGPVIDADAKRTIDTHIAAMKDKGHAVTQLEMPDACAQGTFVPP
FT                   TIIEIGNVDELKREVFGPVLHVVRYRRSGLDKLLEQIRATGYGLTLGIHTRIDETIAHV
FT                   ISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPAGLPRSLE
FT                   AALVADAPQEGETRDNPSAALTALRDWLIEQREPALAARCDGYLSHVLAGATAVLSGPT
FT                   GERNTYTLGARGTVLCIAATASGARAQFAAALATGNRALFAGAAGEALAAALPAQLKAH
FT                   AGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPGPIVSVQGVAAGAFENGGDEDYALE
FT                   RLLTERSVSVNTAAAGGNANLMTIG"
     MASTTLGVKV DDLLRARLKD AASRLERTPH WLIKQAIFAY LERIEHGQLP PELSGHTGVA        60
     DLSDSHADGD DDGAPHPFLE FAQSVQPQSV LRAAITAAYR RPEPECVPFL IGEARLPASL       120
     ASDVQAMAAG LVEALREKSS GGGVEGLIHE FSLSSQEGVA LMCLAEALLR IPDRATRDAL       180
     IRDKISKGDW RSHVGHAPSL FVNAATWGLM ITGKLVTTNS EAGLSSALTR LIGKGGEPLI       240
     RKGVDMAMRL MGEQFVTGET ISEALANSRK YEARGFRYSY DMLGEAATTE EDALRYYASY       300
     EQAIHAIGKA AGGRGIYEGP GISIKLSALH ARYSRSQQER TMNELLPRVR SLALLARRYD       360
     IGLNIDAEEA DRLELSLDLL EALCFDPELA GWNGIGFVVQ AYQKRCPFVI DYLVDLARRS       420
     RHRLMIRLVK GAYWDSEIKR AQVDGLEGYP VYTRKIYTDV SYLACAKKLL AAPDAVYPQF       480
     ATHNAYTLAA IYHLAGQNYY PGQYEFQCLH GMGEPLYEEV TGRDKLNRPC RVYAPVGTHE       540
     TLLAYLVRRL LENGANTSFV NRIADKTVSV KELVADPVED ALKVVPLGAP HAKIALPREL       600
     YGASRVNSMG LDLSNEHRLA SLSSALLASA HHPWRAAPML ADDALAHAAP RDVRNPADLR       660
     DVVGTVSEAT PDEVSAALAH AVAAAPIWQA TPVDARADCL ARAADLLEAQ MHTLMGLIVR       720
     EAGKSLPNAI AEIREAVDFL RYYSAQIRDE FSNDTHRPLG PVVCISPWNF PLAIFMGQVA       780
     AALAAGNTVL AKPAEQTPLI AAQAVRLLRD AGVPAGAVQL LPGNGETVGA ALVADPRTRA       840
     VMFTGSTEVA RLINKTLSSR LDPDGRPIPL IAETGGQNAM IVDSSALAEQ VVADVLQSSF       900
     DSAGQRCSAL RVLCLQDDVA DRTLTMLKGA MRELALGNPD RLSVDVGPVI DADAKRTIDT       960
     HIAAMKDKGH AVTQLEMPDA CAQGTFVPPT IIEIGNVDEL KREVFGPVLH VVRYRRSGLD      1020
     KLLEQIRATG YGLTLGIHTR IDETIAHVIS RAHVGNIYVN RNVIGAVVGV QPFGGEGLSG      1080
     TGPKAGGALY LQRLLATRPA GLPRSLEAAL VADAPQEGET RDNPSAALTA LRDWLIEQRE      1140
     PALAARCDGY LSHVLAGATA VLSGPTGERN TYTLGARGTV LCIAATASGA RAQFAAALAT      1200
     GNRALFAGAA GEALAAALPA QLKAHAGVRK QADAAFDAVL FEGDSDELLA LVKEVAQRPG      1260
     PIVSVQGVAA GAFENGGDED YALERLLTER SVSVNTAAAG GNANLMTIG                  1309
//

If you have problems or comments...

PBIL Back to PBIL home page