(data stored in SCRATCH9089 zone)

EMBL: CP000124.RBSR

CP000124.RBSR        Location/Qualifiers
FT   CDS             complement(533832..534851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="BURPS1710b_0528"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50003"
FT                   /db_xref="GOA:Q3JWW1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW1"
FT                   /protein_id="ABA50003.1"
FT                   /translation="MGTTIRDVAQAANVSIGTVSRALKNQPGLSEATRARIVEIAHRMN
FT                   YDPTQLRPRIKRLTFLLHRQHNNFATTPFFSHVLHGVEDACRERGIVPSLLTTGPTDDV
FT                   IRQMRPHAPDAIAVAGFMEPETLEALAATGRPLVLIDIRAPGLRSINVDNAGGAALAMH
FT                   HLFASGRRRVAFIGGSLAHYSIAQRALGYRRAFFDAGMLFDPSLELSIDTSLGPDAGAA
FT                   NAMRQLLDAGGALPDAVFAYNDAAALAAMRVCVERGVRVPEDIAFVGFDDIPAAAHAAP
FT                   PLTTLAIDKEALGRQGVELLLADSPAQAELSLPVQLVARASSAGAARAPRTLTSVLGS"
     MGTTIRDVAQ AANVSIGTVS RALKNQPGLS EATRARIVEI AHRMNYDPTQ LRPRIKRLTF        60
     LLHRQHNNFA TTPFFSHVLH GVEDACRERG IVPSLLTTGP TDDVIRQMRP HAPDAIAVAG       120
     FMEPETLEAL AATGRPLVLI DIRAPGLRSI NVDNAGGAAL AMHHLFASGR RRVAFIGGSL       180
     AHYSIAQRAL GYRRAFFDAG MLFDPSLELS IDTSLGPDAG AANAMRQLLD AGGALPDAVF       240
     AYNDAAALAA MRVCVERGVR VPEDIAFVGF DDIPAAAHAA PPLTTLAIDK EALGRQGVEL       300
     LLADSPAQAE LSLPVQLVAR ASSAGAARAP RTLTSVLGS                              339
//

If you have problems or comments...

PBIL Back to PBIL home page