(data stored in SCRATCH9089 zone)

EMBL: CP000124.REP

CP000124.REP         Location/Qualifiers
FT   CDS             complement(125845..128046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="BURPS1710b_0122"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48005"
FT                   /db_xref="GOA:Q3JY15"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY15"
FT                   /protein_id="ABA48005.1"
FT                   /translation="MLTCASREPFAAAYHAPAARRSQRLPASSPSTATPSAIMSAGLNS
FT                   AQSEAVRYLDGPCLVLAGAGSGKTRVITQKIAHLIEAKGFEPRHIAAVTFTNKAAAEMR
FT                   ERVGKLLEGKTLTTPGKEGRKVPVNQLTVCTFHSLGVQILRQEAEHVGLKPQFSIMDSD
FT                   DCFGMIQEQIGTTDKGLIRKIQTIISLWKNGLVAPEEAMTIAANEDEHQAALVYRNYVA
FT                   TLHAYQAVDFDDLIRLPTELFARNEPVRDRWQNRLRYLLIDEYQDTNACQYELLKLLAG
FT                   PRAAFTAVGDDDQAIYGWRGATLENLAQLGKDFPKLHVIKLEQNYRSTVRILTAANNVI
FT                   ANNPKLFEKKLWSEHGMGDSITVTPCNDEEHEAESVVFRLSAHKFERRTQFRDYAILYR
FT                   GNFQARVFEQVLRRERIPYVLSGGQSFFDKAEIKDLCAYLRLIANADDDPAFIRAVTTP
FT                   RRGIGNTTLEALGAFAGQAKVSLFEAVYMGGIEARLSARQVEPLRIFCDFIQRLTDRAD
FT                   KEPATVVLDDMMEAIHYEAYLYDAYDERQAQTKWQNVLEFLEWLKRKGTKPEAEQAVDG
FT                   EAEGFHNADGLADTGKNLLGLIQTVALMSMLEGKEEDPDAVRLSTVHASKGLEYPHVFL
FT                   VGVEEGIMPHSGGSDDGPIDDERIEEERRLMYVAITRAQRSLHLNWCKKRKRARETIVC
FT                   EQSRFIAEMGLDEAPPPTPEEAPMTPKDRLASLKALLQK"
     MLTCASREPF AAAYHAPAAR RSQRLPASSP STATPSAIMS AGLNSAQSEA VRYLDGPCLV        60
     LAGAGSGKTR VITQKIAHLI EAKGFEPRHI AAVTFTNKAA AEMRERVGKL LEGKTLTTPG       120
     KEGRKVPVNQ LTVCTFHSLG VQILRQEAEH VGLKPQFSIM DSDDCFGMIQ EQIGTTDKGL       180
     IRKIQTIISL WKNGLVAPEE AMTIAANEDE HQAALVYRNY VATLHAYQAV DFDDLIRLPT       240
     ELFARNEPVR DRWQNRLRYL LIDEYQDTNA CQYELLKLLA GPRAAFTAVG DDDQAIYGWR       300
     GATLENLAQL GKDFPKLHVI KLEQNYRSTV RILTAANNVI ANNPKLFEKK LWSEHGMGDS       360
     ITVTPCNDEE HEAESVVFRL SAHKFERRTQ FRDYAILYRG NFQARVFEQV LRRERIPYVL       420
     SGGQSFFDKA EIKDLCAYLR LIANADDDPA FIRAVTTPRR GIGNTTLEAL GAFAGQAKVS       480
     LFEAVYMGGI EARLSARQVE PLRIFCDFIQ RLTDRADKEP ATVVLDDMME AIHYEAYLYD       540
     AYDERQAQTK WQNVLEFLEW LKRKGTKPEA EQAVDGEAEG FHNADGLADT GKNLLGLIQT       600
     VALMSMLEGK EEDPDAVRLS TVHASKGLEY PHVFLVGVEE GIMPHSGGSD DGPIDDERIE       660
     EERRLMYVAI TRAQRSLHLN WCKKRKRARE TIVCEQSRFI AEMGLDEAPP PTPEEAPMTP       720
     KDRLASLKAL LQK                                                          733
//

If you have problems or comments...

PBIL Back to PBIL home page