(data stored in SCRATCH9089 zone)

EMBL: CP000124.RNPA

CP000124.RNPA        Location/Qualifiers
FT   CDS             312836..313303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="BURPS1710b_0302"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="identified by match to protein family HMM PF00825;
FT                   match to protein family HMM TIGR00188"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49183"
FT                   /db_xref="GOA:Q3JXI5"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI5"
FT                   /protein_id="ABA49183.1"
FT                   /translation="MSAVRSDAGEAAAVRGSIPLQASAAFPKAARLLKTDEFSSVFRLR
FT                   PWRRTAHFVIYGKPTGRDARLGLVIGKKYAARAVTRNLVKRLAREAFRTRRAEFAGWDI
FT                   LLRLHARFDKKAMPSAASAPLAALCAGEIRELLDRAAREVARRNGAKPASE"
     MSAVRSDAGE AAAVRGSIPL QASAAFPKAA RLLKTDEFSS VFRLRPWRRT AHFVIYGKPT        60
     GRDARLGLVI GKKYAARAVT RNLVKRLARE AFRTRRAEFA GWDILLRLHA RFDKKAMPSA       120
     ASAPLAALCA GEIRELLDRA AREVARRNGA KPASE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page