(data stored in SCRATCH9089 zone)

EMBL: CP000124.RPOD

CP000124.RPOD        Location/Qualifiers
FT   CDS             complement(339625..341073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="BURPS1710b_0325"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="identified by match to protein family HMM PF00140;
FT                   match to protein family HMM PF04539; match to protein
FT                   family HMM PF04542; match to protein family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51026"
FT                   /db_xref="GOA:Q3JXG2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG2"
FT                   /protein_id="ABA51026.1"
FT                   /translation="MKVSARELRYEQGIDRLLELAGARDDTEYADVADEFASAPSSAFA
FT                   HDLGEPDSLDHQASDESAGAGSFGDKPTRPAHGDTDVDTDWRDDDAPPSGSNDAAPVDT
FT                   TASTDPLALFVRRMHAVPLLTHAQEIALAAEIEAGREQVLQALAEALDRLDLASLPADP
FT                   ALGRARAALQRARARGDEGARACARARTAAYAALAAHGWPSAEVDAVRRAMRRLPTSPE
FT                   KSDAGAQRAFADGEARISAATARMAEANLRLVLSIARKYASRGLDLADLLQEGNLGLLR
FT                   AIEKFEHRRGFKFSTYATWWIRQAISRAVADRARTIRVPVHVGDEARRVRKAADRIERR
FT                   SGVSASLAELSEATGLPAERLRAVLTLPREPRSLNAPLGDDDQAEFGDIVEDTSTPSLF
FT                   DALAHGQMCDVVTSLLKTMSAQEADILRRRFGIGGDEPWSYEQIAARAGVSREQVRRIE
FT                   KRALQTLRVTAEACNAHDFLDVQP"
     MKVSARELRY EQGIDRLLEL AGARDDTEYA DVADEFASAP SSAFAHDLGE PDSLDHQASD        60
     ESAGAGSFGD KPTRPAHGDT DVDTDWRDDD APPSGSNDAA PVDTTASTDP LALFVRRMHA       120
     VPLLTHAQEI ALAAEIEAGR EQVLQALAEA LDRLDLASLP ADPALGRARA ALQRARARGD       180
     EGARACARAR TAAYAALAAH GWPSAEVDAV RRAMRRLPTS PEKSDAGAQR AFADGEARIS       240
     AATARMAEAN LRLVLSIARK YASRGLDLAD LLQEGNLGLL RAIEKFEHRR GFKFSTYATW       300
     WIRQAISRAV ADRARTIRVP VHVGDEARRV RKAADRIERR SGVSASLAEL SEATGLPAER       360
     LRAVLTLPRE PRSLNAPLGD DDQAEFGDIV EDTSTPSLFD ALAHGQMCDV VTSLLKTMSA       420
     QEADILRRRF GIGGDEPWSY EQIAARAGVS REQVRRIEKR ALQTLRVTAE ACNAHDFLDV       480
     QP                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page