(data stored in SCRATCH9089 zone)

EMBL: CP000124.SDAA

CP000124.SDAA        Location/Qualifiers
FT   CDS             139179..140567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="BURPS1710b_0131"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF03313;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00720"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50967"
FT                   /db_xref="GOA:Q3JY06"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY06"
FT                   /protein_id="ABA50967.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAALMFAQGLERDALLAATAS
FT                   VKVELYGSLGATGKGHGTDRGVMLGLMGDAPDTVDPSTIAARLDAVRTSKTLALLGTHP
FT                   VPFVPKEHIAFYRQALPEHPNAMKLRAADAAGAVLREATYLSVGGGFVVTSGAPNTKVL
FT                   AAAEQMPHPFRTGAELLALTASTGKSIAQLMWENERAWHTEEETRTGLLKIWDVMQSCV
FT                   ARGCGIGNPDADGNLPGPFQVKRRAPQLYRTLTGHPERALQDPLSMVDWINLYAIAVNE
FT                   ENAAGGRVVTAPTNGAAGIIPAVLHYYTRFTPGANEQGVIDFLMTAAAIGILYKLNASI
FT                   SGAEVGCQGEVGVACSMAAGALAAVLGGTPQQVENAAEIGMEHNLGLTCDPVGGMVQIP
FT                   CIERNAMASVKAVNAARMALRGDGSHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVN
FT                   IVEC"
     MAVSVFDLFK IGIGPSSSHT VGPMRAALMF AQGLERDALL AATASVKVEL YGSLGATGKG        60
     HGTDRGVMLG LMGDAPDTVD PSTIAARLDA VRTSKTLALL GTHPVPFVPK EHIAFYRQAL       120
     PEHPNAMKLR AADAAGAVLR EATYLSVGGG FVVTSGAPNT KVLAAAEQMP HPFRTGAELL       180
     ALTASTGKSI AQLMWENERA WHTEEETRTG LLKIWDVMQS CVARGCGIGN PDADGNLPGP       240
     FQVKRRAPQL YRTLTGHPER ALQDPLSMVD WINLYAIAVN EENAAGGRVV TAPTNGAAGI       300
     IPAVLHYYTR FTPGANEQGV IDFLMTAAAI GILYKLNASI SGAEVGCQGE VGVACSMAAG       360
     ALAAVLGGTP QQVENAAEIG MEHNLGLTCD PVGGMVQIPC IERNAMASVK AVNAARMALR       420
     GDGSHYVSLD SVIKTMRETG ADMKTKYKET SRGGLAVNIV EC                          462
//

If you have problems or comments...

PBIL Back to PBIL home page