(data stored in SCRATCH9089 zone)

EMBL: CP000124.SITS

CP000124.SITS        Location/Qualifiers
FT   CDS             602337..603050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sitS"
FT                   /locus_tag="BURPS1710b_0587"
FT                   /product="oxidoreductase homolog"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48677"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ1"
FT                   /protein_id="ABA48677.1"
FT                   /translation="MNLNDAVVLVTGANRGLGLAFVEGLKAAGAKKIYAAARDPARVTT
FT                   PGVQPVRLDVTRAQDIAAAARELRDVNLLVNNAGIFRMGSLLAEADGGGLQAQLDTNFF
FT                   GPLAMARAFAPVLRENGGGAIINVLSVLSWLGLPNTGAYGISKAAAWAATNAIRNELRE
FT                   QRTRVLALHSAYIDTDMVAHAQGVPKNRPEDVVRQTLDALAAGRDEVLVDALTRDVKAG
FT                   LSAEPAVYTQPPTGA"
     MNLNDAVVLV TGANRGLGLA FVEGLKAAGA KKIYAAARDP ARVTTPGVQP VRLDVTRAQD        60
     IAAAARELRD VNLLVNNAGI FRMGSLLAEA DGGGLQAQLD TNFFGPLAMA RAFAPVLREN       120
     GGGAIINVLS VLSWLGLPNT GAYGISKAAA WAATNAIRNE LREQRTRVLA LHSAYIDTDM       180
     VAHAQGVPKN RPEDVVRQTL DALAAGRDEV LVDALTRDVK AGLSAEPAVY TQPPTGA          237
//

If you have problems or comments...

PBIL Back to PBIL home page