(data stored in SCRATCH9089 zone)

EMBL: CP000124.SMF

CP000124.SMF         Location/Qualifiers
FT   CDS             complement(361726..363030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="BURPS1710b_0345"
FT                   /product="SMF family protein"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47594"
FT                   /db_xref="GOA:Q3JXE3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE3"
FT                   /protein_id="ABA47594.1"
FT                   /translation="MIGQSPWARARGIRSISDDENFITALRSPQAALFEEFIMSPRALT
FT                   RAELSGWLRLAGASGVPAAACAALLGAFASLEALFAASHAELAALVGDAAAQSVLAPPA
FT                   ADFEQRVDAALAWLDEPGNALVTRHDPAYPGPLAELYDPPPLLYIKGRVALLHARAVAI
FT                   VGSRGATPQGLADATRFARELSDAGLAIVSGLARGIDGAAHRGGLDGASGTVAVIGTGA
FT                   DLVYPACHHALAHEIAERGALVSEWPLGTPARSAHFPQRNRLIAALSGGVLIVEAALRS
FT                   GSLITARLANEMGRDVFAIPGSIHAPLSQGCHALIRDGAKLVETAADVLDEFGLDPARP
FT                   VNSKRGAPAAASADADLDDDTRRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELA
FT                   GRVAALPGGRYTRIDGAQAEPAQARGTSAVLHSGA"
     MIGQSPWARA RGIRSISDDE NFITALRSPQ AALFEEFIMS PRALTRAELS GWLRLAGASG        60
     VPAAACAALL GAFASLEALF AASHAELAAL VGDAAAQSVL APPAADFEQR VDAALAWLDE       120
     PGNALVTRHD PAYPGPLAEL YDPPPLLYIK GRVALLHARA VAIVGSRGAT PQGLADATRF       180
     ARELSDAGLA IVSGLARGID GAAHRGGLDG ASGTVAVIGT GADLVYPACH HALAHEIAER       240
     GALVSEWPLG TPARSAHFPQ RNRLIAALSG GVLIVEAALR SGSLITARLA NEMGRDVFAI       300
     PGSIHAPLSQ GCHALIRDGA KLVETAADVL DEFGLDPARP VNSKRGAPAA ASADADLDDD       360
     TRRLLDAIGY GPVPLELLAQ RTSLPSGTLH RLLLQLELAG RVAALPGGRY TRIDGAQAEP       420
     AQARGTSAVL HSGA                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page