(data stored in SCRATCH9089 zone)

EMBL: CP000124.SOJ

CP000124.SOJ         Location/Qualifiers
FT   CDS             complement(192195..192965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /locus_tag="BURPS1710b_0188"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49822"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU9"
FT                   /protein_id="ABA49822.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTTVNLAASLAAQGQRVLLIDLDPQGNA
FT                   TMGSGIDKAECESTVYEVLVDGVTVADARVRPEAVKYDVLPANRELAGAEIELVSVENR
FT                   ERQLKAALAKVADDYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVN
FT                   TIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQLKAHFGDKVFDAVIPRNVRLAEA
FT                   PSYGLPGVVFDRGSRGAQAYIQFGAEMIERVRAL"
     MAKIFCVANQ KGGVGKTTTT VNLAASLAAQ GQRVLLIDLD PQGNATMGSG IDKAECESTV        60
     YEVLVDGVTV ADARVRPEAV KYDVLPANRE LAGAEIELVS VENRERQLKA ALAKVADDYD       120
     FVLIDCPPAL SLLTLNGLCA AHGVVIPMQC EYFALEGLSD LVNTIKQVHA NLNRDLKVIG       180
     LLRVMFDPRI TLQQQVSDQL KAHFGDKVFD AVIPRNVRLA EAPSYGLPGV VFDRGSRGAQ       240
     AYIQFGAEMI ERVRAL                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page