(data stored in SCRATCH9089 zone)

EMBL: CP000124.SUN

CP000124.SUN         Location/Qualifiers
FT   CDS             366724..368283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="BURPS1710b_0350"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01189;
FT                   match to protein family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51179"
FT                   /db_xref="GOA:Q3JXD8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD8"
FT                   /protein_id="ABA51179.1"
FT                   /translation="MLRTPPLRAPARVSPIPGALQYRADRPRAGPRRLPTTRPARPCAA
FT                   GTADPMTQTRPSRSRASGAPSRAPRLSALHLVPDSLGFALDGAAQAVDAVDRGAALPAA
FT                   LAAVHAALPSNAQAASRGAIQDIGYRAMRRRGTADWLIAQLVAKAPPAHVHALLVCAFA
FT                   LLVDDEHAAYAPFTVVDQAVTAIGARRECSFAKGLVNAVLRRFLRERAAWLERLQADRR
FT                   ALWNYEPWWIDAVERAWPDAWQRILAAGDAPGPLTLRVNARRMTADAYLDTLRAERIDA
FT                   EKIGLHAIRLASARPVERIPGFADGIVSVQDAGAQLSAEWLGARDGMRVLDACAAPGGK
FT                   TGHILELAHAEVVALESDPARAPRIGENLARLSLTADVRVGDAADPAQWHDGRPFDRVL
FT                   ADVPCSASGIVRRHPDIRWLRRAADIPALVAEQRRILSALWPLVKPGGELLYVTCSIFP
FT                   EEGELQARWFGDACQDAVRLDAPGQLLPQGATGGAPAVGGSGESGRHVDHDGFFYARFQ
FT                   KR"
     MLRTPPLRAP ARVSPIPGAL QYRADRPRAG PRRLPTTRPA RPCAAGTADP MTQTRPSRSR        60
     ASGAPSRAPR LSALHLVPDS LGFALDGAAQ AVDAVDRGAA LPAALAAVHA ALPSNAQAAS       120
     RGAIQDIGYR AMRRRGTADW LIAQLVAKAP PAHVHALLVC AFALLVDDEH AAYAPFTVVD       180
     QAVTAIGARR ECSFAKGLVN AVLRRFLRER AAWLERLQAD RRALWNYEPW WIDAVERAWP       240
     DAWQRILAAG DAPGPLTLRV NARRMTADAY LDTLRAERID AEKIGLHAIR LASARPVERI       300
     PGFADGIVSV QDAGAQLSAE WLGARDGMRV LDACAAPGGK TGHILELAHA EVVALESDPA       360
     RAPRIGENLA RLSLTADVRV GDAADPAQWH DGRPFDRVLA DVPCSASGIV RRHPDIRWLR       420
     RAADIPALVA EQRRILSALW PLVKPGGELL YVTCSIFPEE GELQARWFGD ACQDAVRLDA       480
     PGQLLPQGAT GGAPAVGGSG ESGRHVDHDG FFYARFQKR                              519
//

If you have problems or comments...

PBIL Back to PBIL home page