(data stored in SCRATCH9089 zone)

EMBL: CP000124.TNPA

CP000124.TNPA        Location/Qualifiers
FT   CDS             complement(502669..503889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="BURPS1710b_0496"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49392"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ3"
FT                   /protein_id="ABA49392.1"
FT                   /translation="MLDRKALQALGCWTGYRLERVEWPQGDSRTLSLYLKPVSQIMYCE
FT                   QCGARCQQIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGAARLEKLDWLGRYQRVT
FT                   ERFAKACEKLLQAASVQAVAAFYELGWHTVKSIDKMRLRARVAEPDWSTIRYLAMDEFA
FT                   LHKGHRYATVVVDPIGRQVLWVGPGRSRETARAFFEQLPEGVAERIEAVAIDMTTAYEL
FT                   EIKEQCPQAEIVFDLYHVVAKYGREVIDRVRVDQANQLRHDKPARKVLKSSRWLLLRNR
FT                   HNLKPEQAVHLKELLAANQSLLCVYVLRDELKRLWFYRKPAWAEKAWGQWFEQAQQSGI
FT                   AALQKFAQRLQGYWHGIVARCRHPLNTSVVEGINNTIKVIKRRAYGYRDEQYFFLKIRA
FT                   AFPGIPR"
     MLDRKALQAL GCWTGYRLER VEWPQGDSRT LSLYLKPVSQ IMYCEQCGAR CQQIHETTVR        60
     RVRDLPLFEY RVVLHVPRRR VWCERCGAAR LEKLDWLGRY QRVTERFAKA CEKLLQAASV       120
     QAVAAFYELG WHTVKSIDKM RLRARVAEPD WSTIRYLAMD EFALHKGHRY ATVVVDPIGR       180
     QVLWVGPGRS RETARAFFEQ LPEGVAERIE AVAIDMTTAY ELEIKEQCPQ AEIVFDLYHV       240
     VAKYGREVID RVRVDQANQL RHDKPARKVL KSSRWLLLRN RHNLKPEQAV HLKELLAANQ       300
     SLLCVYVLRD ELKRLWFYRK PAWAEKAWGQ WFEQAQQSGI AALQKFAQRL QGYWHGIVAR       360
     CRHPLNTSVV EGINNTIKVI KRRAYGYRDE QYFFLKIRAA FPGIPR                      406
//

If you have problems or comments...

PBIL Back to PBIL home page