(data stored in SCRATCH9089 zone)

EMBL: CP000124.TTK

CP000124.TTK         Location/Qualifiers
FT   CDS             complement(395997..396689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="BURPS1710b_0378"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48324"
FT                   /db_xref="GOA:Q3JXB1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB1"
FT                   /protein_id="ABA48324.1"
FT                   /translation="MQPTHPHDPAVTAAAENERSAATASRTRPKPGERRVHILQTLASM
FT                   LEAPKSEKITTAALAARLDVSEAALYRHFSSKAQMFEGLIEFIEETFFGLVNQIAANEP
FT                   NGVLQARSIALMLLNFSAKNPGMTRVLTGEALVGEHERLAERVNQMLERVEASIKQCLR
FT                   VALLEAQAHAAGGGAPPPVPLPDDYDPALRASLVISYVLGRWHRYAKSGFTKAPGEHAD
FT                   AQLRLILQ"
     MQPTHPHDPA VTAAAENERS AATASRTRPK PGERRVHILQ TLASMLEAPK SEKITTAALA        60
     ARLDVSEAAL YRHFSSKAQM FEGLIEFIEE TFFGLVNQIA ANEPNGVLQA RSIALMLLNF       120
     SAKNPGMTRV LTGEALVGEH ERLAERVNQM LERVEASIKQ CLRVALLEAQ AHAAGGGAPP       180
     PVPLPDDYDP ALRASLVISY VLGRWHRYAK SGFTKAPGEH ADAQLRLILQ                  230
//

If you have problems or comments...

PBIL Back to PBIL home page