(data stored in ACNUC7421 zone)

EMBL: CP000247.PE10

CP000247.PE10        Location/Qualifiers
FT   CDS             9205..9792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0010"
FT                   /product="molybdopterin biosynthesis mog protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68052"
FT                   /db_xref="GOA:A0A454A0T3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0T3"
FT                   /protein_id="ABG68052.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETR
FT                   LIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVP
FT                   YCIQLLEGPYVETAPEVVAAFRPKSARREVSE"
     MNTLRIGLVS ISDRASSGVY QDKGIPALEE WLTSALTTPF ELETRLIPDE QAIIEQTLCE        60
     LVDEMSCHLV LTTGGTGPAR RDVTPDATLA VADREMPGFG EQMRQISLHF VPTAILSRQV       120
     GVIRKQALIL NLPGQPKSIK ETLEGVKDAE GNVVVHGIFA SVPYCIQLLE GPYVETAPEV       180
     VAAFRPKSAR REVSE                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page