(data stored in ACNUC7421 zone)

EMBL: CP000247.PE101

CP000247.PE101       Location/Qualifiers
FT   CDS             112362..112760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0101"
FT                   /product="mutator MutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68141"
FT                   /db_xref="GOA:A0A454A0Y8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Y8"
FT                   /protein_id="ABG68141.1"
FT                   /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKVEMGET
FT                   PEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVESWEGEPWGKEGQPGEW
FT                   MSLVGLNADDFPPANEPVIAKLKRVYAG"
     MKKLQIAVGI IRNENNEIFI TRRAADAHMA NKLEFPGGKV EMGETPEQAV VRELQEEVGI        60
     TPQHFSLFEK LEYEFPDRHI TLWFWLVESW EGEPWGKEGQ PGEWMSLVGL NADDFPPANE       120
     PVIAKLKRVY AG                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page