(data stored in ACNUC7421 zone)

EMBL: CP000247.PE104

CP000247.PE104       Location/Qualifiers
FT   CDS             complement(113798..114418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0104"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68144"
FT                   /db_xref="GOA:A0A454A0Y5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Y5"
FT                   /protein_id="ABG68144.1"
FT                   /translation="MRYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGANMIAADGTLQRRALRERIFANPEEKNWLNALLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAYYLQLASQFVSQEKP"
     MRYIVALTGG IGSGKSTVAN AFADLGINVI DADIIARQVV EPGAPALHAI ADHFGANMIA        60
     ADGTLQRRAL RERIFANPEE KNWLNALLHP LIQQETQHQI QQATSPYVLW VVPLLVENSL       120
     YKKANRVLVV DVSPETQLKR TMQRDDVTRE HVEQILAAQA TREARLAVAD DVIDNNGAPD       180
     AIASDVARLH AYYLQLASQF VSQEKP                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page