(data stored in ACNUC7421 zone)

EMBL: CP000247.PE107

CP000247.PE107       Location/Qualifiers
FT   CDS             complement(116913..118298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0107"
FT                   /product="general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68147"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A104"
FT                   /protein_id="ABG68147.1"
FT                   /translation="MNIPQLTALCLRYQGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLACRGGEKVVLRLLQQVNQALDVNTLGMQPSQLVDFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTLNTADINICSVEDPVEIPIAGLNQTQIHSRAGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPDNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
     MNIPQLTALC LRYQGVLLDA SEEVVHVAVV DAPSHELLDA LHFATTKRIE ITCWTRQQME        60
     GHASRTQQTL PVAVQEKHQP KAELLTRTLQ SALEQRASDI HIEPADNAYR IRLRIDGVLH       120
     PLPDVSPDAG VALTARLKVL GNLDIAEHRL PQDGQFTVEL AGNAVSFRIA TLACRGGEKV       180
     VLRLLQQVNQ ALDVNTLGMQ PSQLVDFAHA LQQPQGLVLV TGPTGSGKTV TLYSALQTLN       240
     TADINICSVE DPVEIPIAGL NQTQIHSRAG LTFQGVLRAL LRQDPDVIMI GEIRDGETAE       300
     IAIKAAQTGH LVLSTLHTNS TCETLVRLQQ MGVARWMLSS ALTLVIAQRL VRKLCPHCRR       360
     QQGEPIHIPD NVWPSPLPHW QAPGCVHCYH GFYGRTALFE VLPITPVIRQ LISANTDVES       420
     LETHARQAGM RTLFENGCLA VEQGLTTFEE LIRVLGMPHG E                           461
//

If you have problems or comments...

PBIL Back to PBIL home page