(data stored in ACNUC7421 zone)

EMBL: CP000247.PE108

CP000247.PE108       Location/Qualifiers
FT   CDS             complement(118308..118748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0108"
FT                   /product="prepilin peptidase dependent protein D precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68148"
FT                   /db_xref="GOA:A0A454A0Y9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Y9"
FT                   /protein_id="ABG68148.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLNTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWTRNCNIQSDSALQQACEDVFRFDDAN"
     MDKQRGFTLI ELMVVIGIIA ILSAIGIPAY QNYLRKAALT DMLQTFVPYR TAVELCALEH        60
     GGLNTCDGGS NGIPSPTTTR YVSAMSVAKG VVSLTGQESL NGLSVVMTPG WDNANGVTGW       120
     TRNCNIQSDS ALQQACEDVF RFDDAN                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page