(data stored in ACNUC7421 zone)

EMBL: CP000247.PE11

CP000247.PE11        Location/Qualifiers
FT   CDS             complement(9997..10563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0011"
FT                   /product="hypothetical protein YaaH"
FT                   /note="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68053"
FT                   /db_xref="GOA:A0A454A0T9"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0T9"
FT                   /protein_id="ABG68053.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGIFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGESH"
     MGNTKLANPA PLGLMGFGMT TILLNLHNVG YFALDGIILA MGIFYGGIAQ IFAGLLEYKK        60
     GNTFGLTAFT SYGSFWLTLV AILLMPKLGL TDAPNAQFLG VYLGLWGIFT LFMFFGTLKG       120
     ARVLQFVFFS LTVLFALLAI GNIAGNAAII HFAGWIGLIC GASAIYLAMG EVLNEQFGRT       180
     VLPIGESH                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page