(data stored in ACNUC7421 zone)

EMBL: CP000247.PE111

CP000247.PE111       Location/Qualifiers
FT   CDS             120481..121335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0111"
FT                   /product="AmpE protein"
FT                   /note="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68151"
FT                   /db_xref="GOA:A0A454A0Z1"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Z1"
FT                   /protein_id="ABG68151.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLC
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDGVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFHTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
     MTLFTTLLVL IFERLFKLGE HWQLDHRLEA FFRRVKHFSL GRTLCMTIIA MGVTFLLLRA        60
     LQGVLFNVPT LLVWLLIGLL CIGAGKVRLH YHAYLTAASR NDSHARATMA GELTMIHGVP       120
     AGCDEREYLR ELQNALLWIN FRFYLAPLFW LIVGGTWGPV TLMGYAFLRA WQYWLARYQT       180
     PHHRLQSGID GVLHVLDWVP VRLAGVVYAL IGHGEKALPA WFASLGDFHT SQYQVLTRLA       240
     QFSLAREPHV DKVETPKAAV SMAKKTSFVV VVVIALLTIY GALV                        284
//

If you have problems or comments...

PBIL Back to PBIL home page