(data stored in ACNUC7421 zone)

EMBL: CP000247.PE114

CP000247.PE114       Location/Qualifiers
FT   CDS             125060..125344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0114"
FT                   /product="colicin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68154"
FT                   /db_xref="GOA:A0A454A0Y7"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Y7"
FT                   /protein_id="ABG68154.1"
FT                   /translation="MFKEKLEDYTEEEFLNFLGGLRSTMKDGKPLKGKELEMYWDSLVD
FT                   HFIEITQHPSGSDLIFYPKSQGDDKPENILKIVKEWRRSQGLPLFKDSK"
     MFKEKLEDYT EEEFLNFLGG LRSTMKDGKP LKGKELEMYW DSLVDHFIEI TQHPSGSDLI        60
     FYPKSQGDDK PENILKIVKE WRRSQGLPLF KDSK                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page