(data stored in ACNUC7421 zone)

EMBL: CP000247.PE116

CP000247.PE116       Location/Qualifiers
FT   CDS             125752..126042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0116"
FT                   /product="colicin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68156"
FT                   /db_xref="GOA:A0A454A101"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A101"
FT                   /protein_id="ABG68156.1"
FT                   /translation="MYNFKDKIEDYTEREFIELLGEFTNPTGDNAQLKGEELDKYWDDL
FT                   EEHLTRITQHPLMSDLIYYPAKKGDDEPENILKIVKEWRRSQGLPLFKDSK"
     MYNFKDKIED YTEREFIELL GEFTNPTGDN AQLKGEELDK YWDDLEEHLT RITQHPLMSD        60
     LIYYPAKKGD DEPENILKIV KEWRRSQGLP LFKDSK                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page