(data stored in ACNUC7421 zone)

EMBL: CP000247.PE120

CP000247.PE120       Location/Qualifiers
FT   CDS             complement(127958..128140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68160"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A111"
FT                   /protein_id="ABG68160.1"
FT                   /translation="MGNVLTWVIPYLSNNVEFSGTCPIELSPESSIRQVLRLVAALLYA
FT                   LDLQHLLDNFYQKNH"
     MGNVLTWVIP YLSNNVEFSG TCPIELSPES SIRQVLRLVA ALLYALDLQH LLDNFYQKNH        60
//

If you have problems or comments...

PBIL Back to PBIL home page