(data stored in ACNUC7421 zone)

EMBL: CP000247.PE124

CP000247.PE124       Location/Qualifiers
FT   CDS             complement(134566..136323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0124"
FT                   /product="hypothetical integral membrane protein YacH"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68164"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Z0"
FT                   /protein_id="ABG68164.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVEAQSTQQ
FT                   TAPDISAVTLPATVSVPPVTPAVVKSTFSTAQIDQWVAPVALYPDSLLSQVLMASTYPA
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSGQSWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKIITTTKKVVPVNQPANAPATQSNTVST
FT                   SSPVVAEPAPTVITIEPANPDVVYIPNYNPNVVYGSWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDDYHHHDGGHRDGNDWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVTYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHTAPVITRDTQRQAAAQRFNEAEHNGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAAREKMQTNPQNQQRREAARQRIQSASPEQRQAVREKMQTN
FT                   PQNQQQRDAARQRIQSASPEQRQVFREKVQESRPQRLNDSNHTARLNNEQRSAVRERLS
FT                   ERGARRLER"
     MKMTLPFKPH VLALICSAGL CAASAGLYIK SRTVEAPVEA QSTQQTAPDI SAVTLPATVS        60
     VPPVTPAVVK STFSTAQIDQ WVAPVALYPD SLLSQVLMAS TYPANVAQAV QWSHDNPLKQ       120
     GDAAIQAVSG QSWDASVKSL VAFPQLMALM GENPQWVQNL GDAFLAQPQD VMDSVQRLRQ       180
     LAQQTGSLKS STEQKIITTT KKVVPVNQPA NAPATQSNTV STSSPVVAEP APTVITIEPA       240
     NPDVVYIPNY NPNVVYGSWA NTAYPPVYLP PPAGEPFVDS FVRGFGYSMG VATTYALFSS       300
     IDWDDDDHDH HHHDDDDYHH HDGGHRDGND WQHNGDNINI DVNNFNRITG EHLTDKNMAW       360
     RHNPNYRNGV TYHDQDMAKR FHQTDVNGGM SATQLPAPTR DSQRQAAASQ FQQRTHTAPV       420
     ITRDTQRQAA AQRFNEAEHN GSYDDFRDFS RRQPLTQQQK DAARQRYQSA SPEQRQAARE       480
     KMQTNPQNQQ RREAARQRIQ SASPEQRQAV REKMQTNPQN QQQRDAARQR IQSASPEQRQ       540
     VFREKVQESR PQRLNDSNHT ARLNNEQRSA VRERLSERGA RRLER                       585
//

If you have problems or comments...

PBIL Back to PBIL home page