(data stored in ACNUC7421 zone)

EMBL: CP000247.PE144

CP000247.PE144       Location/Qualifiers
FT   CDS             complement(155139..155453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68184"
FT                   /db_xref="GOA:A0A454A100"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A100"
FT                   /protein_id="ABG68184.1"
FT                   /translation="MGSVSKELLANTLTGNDAAKGVGVLIEGLKNTKSAQMVLKPNDAT
FT                   SIYKDYETENDTTGGIFPDNGNGGTSQPLHFQATLKQDGNIAIEPGDFKATSTFQVTYP
FT                   "
     MGSVSKELLA NTLTGNDAAK GVGVLIEGLK NTKSAQMVLK PNDATSIYKD YETENDTTGG        60
     IFPDNGNGGT SQPLHFQATL KQDGNIAIEP GDFKATSTFQ VTYP                        104
//

If you have problems or comments...

PBIL Back to PBIL home page