(data stored in ACNUC7421 zone)

EMBL: CP000247.PE146

CP000247.PE146       Location/Qualifiers
FT   CDS             complement(156452..157048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0146"
FT                   /product="protein YadK"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68186"
FT                   /db_xref="GOA:A0A454A115"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A115"
FT                   /protein_id="ABG68186.1"
FT                   /translation="MRPTQRNLMKKSILILSLLFSATSPVVAGQDVDIVANIKNNTCQS
FT                   GISNNGNIDLGVVGVGDFTGNISAENYHPGGKEFTITVQDCTLQGTGNVLNQLHINFRA
FT                   LSGVMATGSSQIFANEDNAGAKNVGVVIFSIQDPANTFNVLSATGSSRSVYPVMSSALN
FT                   NSSWKFSTRMQKIDPALNVTSGPLISHVLVDIYYE"
     MRPTQRNLMK KSILILSLLF SATSPVVAGQ DVDIVANIKN NTCQSGISNN GNIDLGVVGV        60
     GDFTGNISAE NYHPGGKEFT ITVQDCTLQG TGNVLNQLHI NFRALSGVMA TGSSQIFANE       120
     DNAGAKNVGV VIFSIQDPAN TFNVLSATGS SRSVYPVMSS ALNNSSWKFS TRMQKIDPAL       180
     NVTSGPLISH VLVDIYYE                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page