(data stored in ACNUC7421 zone)

EMBL: CP000247.PE149

CP000247.PE149       Location/Qualifiers
FT   CDS             complement(158278..160866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0149"
FT                   /product="outer membrane usher protein HtrE precursor"
FT                   /note="heat shock protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68189"
FT                   /db_xref="GOA:A0A454A119"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A119"
FT                   /protein_id="ABG68189.1"
FT                   /translation="MTIKSTNHLTHIATFCALLYSNSALCAELVEYDHTFLMGKDASNI
FT                   DLSRYTEGNPTLPGIYDVSVYVNDQPIMSQSIAFAVIEGKKNAQACITQKNLLQFHISS
FT                   PDKNSEKAILLKRDEDLGDCLNLAEMIPQSSIRYDVNDQRLDIDVPQAWIMKNYQNYVD
FT                   PSLWENGINAAMLSYNLNGYHSESPGRTNDSIYAAFNGGINLGAWRLRASGNYNWMTNV
FT                   HSDYDFQNRYLQRDLASLRSQLVIGESYTTGETFDSVSIRGIRLYSDSRMLPPVLASFA
FT                   PIIHGVANTNAKVTVMQNGYKIYETTVPPGAFAIDDLSPSGYGSDLIVTIEEADGTKRT
FT                   FSQPFSSVVQMLRPGVGRWDISAGQVLKDSIQDEPNLFQASYYYGLNNYLTGYTGIQLT
FT                   DNNYTAGLLGLGMNTPVGAFSVDVTHSNVSIPDDKTYQGQSYRISWNKLFENTSTSLNI
FT                   AAYRYSTQHYLGLNDALTLIDEVEHPEQELEPKSMRNYSRMKNQVTVSINQPLKFEKKD
FT                   YGSFYLSGSWSDYWASGQNSTNYSIGYSNSASWGSYSISAQRSLNEDGQTDDSIYLSFT
FT                   IPIENLLGTEHRSSGFQSIDTQLNSDFKGNNQLNISSSGYSDTNRISYSVNTGYMMNKS
FT                   SDDLSYIGGYASYESPWGTLSGSASASSDNSRQFSLNTDGGFVLHSGGLTFSNDSFSDS
FT                   DTLAVIQAPGAKGARINYGNSTVDRWGYGVTSALSPYHENRIALDINDLENDVELKSTS
FT                   TVAVPRQGAVVFADFETVQGQSAIMNIVRSDGKNIPFAADIYDEQNNIIGNVGQGGQAF
FT                   VRGIGQEGNIRITWIEEGKPVSCFAHYQQNTTSEKIAQSIILNGLRCQIQ"
     MTIKSTNHLT HIATFCALLY SNSALCAELV EYDHTFLMGK DASNIDLSRY TEGNPTLPGI        60
     YDVSVYVNDQ PIMSQSIAFA VIEGKKNAQA CITQKNLLQF HISSPDKNSE KAILLKRDED       120
     LGDCLNLAEM IPQSSIRYDV NDQRLDIDVP QAWIMKNYQN YVDPSLWENG INAAMLSYNL       180
     NGYHSESPGR TNDSIYAAFN GGINLGAWRL RASGNYNWMT NVHSDYDFQN RYLQRDLASL       240
     RSQLVIGESY TTGETFDSVS IRGIRLYSDS RMLPPVLASF APIIHGVANT NAKVTVMQNG       300
     YKIYETTVPP GAFAIDDLSP SGYGSDLIVT IEEADGTKRT FSQPFSSVVQ MLRPGVGRWD       360
     ISAGQVLKDS IQDEPNLFQA SYYYGLNNYL TGYTGIQLTD NNYTAGLLGL GMNTPVGAFS       420
     VDVTHSNVSI PDDKTYQGQS YRISWNKLFE NTSTSLNIAA YRYSTQHYLG LNDALTLIDE       480
     VEHPEQELEP KSMRNYSRMK NQVTVSINQP LKFEKKDYGS FYLSGSWSDY WASGQNSTNY       540
     SIGYSNSASW GSYSISAQRS LNEDGQTDDS IYLSFTIPIE NLLGTEHRSS GFQSIDTQLN       600
     SDFKGNNQLN ISSSGYSDTN RISYSVNTGY MMNKSSDDLS YIGGYASYES PWGTLSGSAS       660
     ASSDNSRQFS LNTDGGFVLH SGGLTFSNDS FSDSDTLAVI QAPGAKGARI NYGNSTVDRW       720
     GYGVTSALSP YHENRIALDI NDLENDVELK STSTVAVPRQ GAVVFADFET VQGQSAIMNI       780
     VRSDGKNIPF AADIYDEQNN IIGNVGQGGQ AFVRGIGQEG NIRITWIEEG KPVSCFAHYQ       840
     QNTTSEKIAQ SIILNGLRCQ IQ                                                862
//

If you have problems or comments...

PBIL Back to PBIL home page