(data stored in ACNUC7421 zone)

EMBL: CP000247.PE151

CP000247.PE151       Location/Qualifiers
FT   CDS             complement(161750..162340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0151"
FT                   /product="hypothetical fimbrial-like protein YadN
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68191"
FT                   /db_xref="GOA:A0A454A138"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A138"
FT                   /protein_id="ABG68191.1"
FT                   /translation="MSKKLGFVLSGIMLAMAAGTAFAANDMDGGQLNISGLVVDNTCEA
FT                   RVDGGNKDGLILLQTATVAEITDGVLDTTVGAKAKPFSITIDCSKANPAPGTTAKMTFG
FT                   SVFFGNSKGTLNNDMSINTPSDGVNIALHNIEGSIIKQVQVNNPGDVYSKTLDSTSKSA
FT                   TYDFKASYVRADASKAATAGYVKTNSAYTITYQ"
     MSKKLGFVLS GIMLAMAAGT AFAANDMDGG QLNISGLVVD NTCEARVDGG NKDGLILLQT        60
     ATVAEITDGV LDTTVGAKAK PFSITIDCSK ANPAPGTTAK MTFGSVFFGN SKGTLNNDMS       120
     INTPSDGVNI ALHNIEGSII KQVQVNNPGD VYSKTLDSTS KSATYDFKAS YVRADASKAA       180
     TAGYVKTNSA YTITYQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page