(data stored in ACNUC7421 zone)

EMBL: CP000247.PE155

CP000247.PE155       Location/Qualifiers
FT   CDS             complement(165598..166053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0155"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68195"
FT                   /db_xref="GOA:A0A454A130"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A130"
FT                   /protein_id="ABG68195.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
     MQEGQNRKTS SLSILAIAGV EPYQEKPGEE YMNEAQLAHF RRILEAWRNQ LRDEVDRTVT        60
     HMQDEAANFP DPVDRAAQEE EFSLELRNRD RERKLIKKIE KTLKKVEDED FGYCESCGVE       120
     IGIRRLEARP TADLCIDCKT LAEIREKQMA G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page