(data stored in ACNUC7421 zone)

EMBL: CP000247.PE16

CP000247.PE16        Location/Qualifiers
FT   CDS             15461..15748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0U5"
FT                   /protein_id="ABG68058.1"
FT                   /translation="MLLLGFVSRENSNLRLASSDVNLTEVFSRYQRRHYGGDTDDDQGD
FT                   NHRLMLLHCSLLLDLSVSKRHSTCVLHIGGLGLMVKYHSGLFSICRSANA"
     MLLLGFVSRE NSNLRLASSD VNLTEVFSRY QRRHYGGDTD DDQGDNHRLM LLHCSLLLDL        60
     SVSKRHSTCV LHIGGLGLMV KYHSGLFSIC RSANA                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page