(data stored in ACNUC7421 zone)

EMBL: CP000247.PE162

CP000247.PE162       Location/Qualifiers
FT   CDS             175922..176812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0162"
FT                   /product="ferrichrome-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68202"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A144"
FT                   /protein_id="ABG68202.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPFLWQMNTAHAAVIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLTHYEDFIR
FT                   SMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMNALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRILDNAIGGKA"
     MSGLPLISRR RLLTAMALSP FLWQMNTAHA AVIDPNRIVA LEWLPVELLL ALGIVPYGVA        60
     DTINYRLWVS EPPLPDSVID VGLRTEPNLE LLTEMKPSFM VWSAGYGPSP EMLARIAPGR       120
     GFNFSDGKQP LAMARKSLTE MADLLNLQSA AETHLTHYED FIRSMKPRFV KRGARPLLLT       180
     TLIDPRHMLV FGPNSLFQEI LDEYGIPNAW QGETNFWGST AVSIDRLAAY KDVDVLCFDH       240
     DNSKDMNALM ATPLWQAMPF VRAGRFQRVP AVWFYGATLS AMHFVRILDN AIGGKA           296
//

If you have problems or comments...

PBIL Back to PBIL home page