(data stored in ACNUC7421 zone)

EMBL: CP000247.PE167

CP000247.PE167       Location/Qualifiers
FT   CDS             complement(182225..182848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0167"
FT                   /product="putative membrane protein YadS"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68207"
FT                   /db_xref="GOA:A0A454A131"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A131"
FT                   /protein_id="ABG68207.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
     MLVYWLDIVG TAVFAISGVL LAGKLRMDPF GVLVLGVVTA VGGGTIRDMA LDHGPVFWVK        60
     DPTDLVVAMV TSMLTIVLVR QPRRLPKWML PVLDAVGLAV FVGIGVNKAF NAEAGPLIAV       120
     CMGVITGVGG GIIRDVLARE IPMILRTEIY ATACIIGGIV HATAYYTFSV PLETASMMGM       180
     VVTLLIRLAA IRWHLKLPTF ALDENGR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page