(data stored in ACNUC7421 zone)

EMBL: CP000247.PE168

CP000247.PE168       Location/Qualifiers
FT   CDS             complement(183071..183688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0168"
FT                   /product="periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68208"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A139"
FT                   /protein_id="ABG68208.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIGQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFG
FT                   INPPFTQWKRVDSEPGTRSFVAEKTSLKTAGFPGRKLAANRC"
     MAKSLFRALV ALSFLAPLWL NAAPRVITLS PANTELAFAA GITPVGVSSY SDYPPQAQKI        60
     GQVSTWQGMN LERIVALKPD LVIAWRGGNA ERQVDQLASL GIKVMWVDAT SIEQIANALR       120
     QLAPWSPQPD KAEQAAQSLL DQYAQLKAQY ADKPKKRVFL QFGINPPFTQ WKRVDSEPGT       180
     RSFVAEKTSL KTAGFPGRKL AANRC                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page