(data stored in ACNUC7421 zone)

EMBL: CP000247.PE188

CP000247.PE188       Location/Qualifiers
FT   CDS             206309..206764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0188"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68228"
FT                   /db_xref="GOA:Q0TLF3"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLF3"
FT                   /protein_id="ABG68228.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
     MTTNTHTLQI EEILELLPHR FPFLLVDRVL DFEEGRFLRA VKNVSVNEPF FQGHFPGKPI        60
     FPGVLILEAM AQATGILAFK SVGKLEPGEL YYFAGIDEAR FKRPVVPGDQ MIMEVTFEKT       120
     RRGLTRFKGV ALVDGKVVCE ATMMCARSRE A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page