(data stored in ACNUC7421 zone)

EMBL: CP000247.PE195

CP000247.PE195       Location/Qualifiers
FT   CDS             216084..216473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0195"
FT                   /product="glyoxylase I family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68235"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A156"
FT                   /protein_id="ABG68235.1"
FT                   /translation="MLGLKQVHHIAIIATDYAMSKAFYCDILGFTLQSEVYREARDSWK
FT                   GDLALNGQYVIELFSFPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLESHNVKCEAIR
FT                   VDPYTQKRFTFFNDPDGLPLELYEQ"
     MLGLKQVHHI AIIATDYAMS KAFYCDILGF TLQSEVYREA RDSWKGDLAL NGQYVIELFS        60
     FPFPPERPSR PEACGLRHLA FSVDDIDAAV AHLESHNVKC EAIRVDPYTQ KRFTFFNDPD       120
     GLPLELYEQ                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page