(data stored in ACNUC7421 zone)

EMBL: CP000247.PE202

CP000247.PE202       Location/Qualifiers
FT   CDS             complement(220342..220896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68242"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A175"
FT                   /protein_id="ABG68242.1"
FT                   /translation="MSHVAIYLGDNNVAEATGAGVQIVSLKKAIKHSDKLFVLRVPDLT
FT                   PQQATEITAFANKIKDSGYNYRGIVEFIPFMVTRQMCSLNPFSEDFRQQCVSGLAKAQL
FT                   SSVGEGDKKSWFCSEFVTDAFAKAGHPLTLAQSGWISPADLMHMRTGDISAFKPETQLQ
FT                   YVGHMKPGIYIKAGRFVGLTQ"
     MSHVAIYLGD NNVAEATGAG VQIVSLKKAI KHSDKLFVLR VPDLTPQQAT EITAFANKIK        60
     DSGYNYRGIV EFIPFMVTRQ MCSLNPFSED FRQQCVSGLA KAQLSSVGEG DKKSWFCSEF       120
     VTDAFAKAGH PLTLAQSGWI SPADLMHMRT GDISAFKPET QLQYVGHMKP GIYIKAGRFV       180
     GLTQ                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page