(data stored in ACNUC7421 zone)

EMBL: CP000247.PE209

CP000247.PE209       Location/Qualifiers
FT   CDS             complement(225774..226805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0209"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68249"
FT                   /db_xref="GOA:Q0TLD2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLD2"
FT                   /protein_id="ABG68249.1"
FT                   /translation="MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKDEIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFADCVPMLRLEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVL
FT                   GYV"
     MIKLSNITKV FHQGTRTIQA LNNVSLHVPA GQIYGVIGAS GAGKSTLIRC VNLLERPTEG        60
     SVLVDGQELT TLSESELTKA RRQIGMIFQH FNLLSSRTVF GNVALPLELD NTPKDEIKRR       120
     VTELLSLVGL GDKHDSYPSN LSGGQKQRVA IARALASNPK VLLCDEATSA LDPATTRSIL       180
     ELLKDINRRL GLTILLITHE MDVVKRICDC VAVISNGELI EQDTVSEVFS HPKTPLAQKF       240
     IQSTLHLDIP EDYQERLQAE PFADCVPMLR LEFTGQSVDA PLLSETARRF NVNNNIISAQ       300
     MDYAGGVKFG IMLTEMHGTQ QDTQAAIAWL QEHHVKVEVL GYV                         343
//

If you have problems or comments...

PBIL Back to PBIL home page