(data stored in ACNUC7421 zone)

EMBL: CP000247.PE21

CP000247.PE21        Location/Qualifiers
FT   CDS             21357..22262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0021"
FT                   /product="transcriptional activator protein NhaR"
FT                   /note="Na+/H+ antiporter regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68063"
FT                   /db_xref="GOA:A0A454A0U2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0U2"
FT                   /protein_id="ABG68063.1"
FT                   /translation="MSMSHINYNHLYYFWHVYKEGSVVGAAEALYLTPQTITGQIRALE
FT                   ERLQGKLFKRKGRGLEPSELGELVYRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADA
FT                   LSKRLVSSVLDAAVVEDEQIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLF
FT                   SMKIGECGVSFWCTNPLPEKPFPACLEERRLLIPGRRSMLGRKLLNWFNSQGLNVEILG
FT                   EFDDAALMKAFGATHNAIFVAPSLYANDFYNDDSVVEIGRVENVMEEYHAIFAERMIQH
FT                   PAVQRICNTDYSALFTPASK"
     MSMSHINYNH LYYFWHVYKE GSVVGAAEAL YLTPQTITGQ IRALEERLQG KLFKRKGRGL        60
     EPSELGELVY RYADKMFTLS QEMLDIVNYR KESNLLFDVG VADALSKRLV SSVLDAAVVE       120
     DEQIHLRCFE STHEMLLEQL SQHKLDMIIS DCPIDSTQQE GLFSMKIGEC GVSFWCTNPL       180
     PEKPFPACLE ERRLLIPGRR SMLGRKLLNW FNSQGLNVEI LGEFDDAALM KAFGATHNAI       240
     FVAPSLYAND FYNDDSVVEI GRVENVMEEY HAIFAERMIQ HPAVQRICNT DYSALFTPAS       300
     K                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page