(data stored in ACNUC7421 zone)

EMBL: CP000247.PE217

CP000247.PE217       Location/Qualifiers
FT   CDS             239103..239828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0219"
FT                   /product="hypothetical protein YafS"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68257"
FT                   /db_xref="GOA:A0A454A166"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A166"
FT                   /protein_id="ABG68257.1"
FT                   /translation="MMKPARVPQTVVAPDCWGDLPWGELYRKALERQLNPWFTKMYGFH
FT                   LLKIGNLSAEINCEACAVSHQVNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWC
FT                   TDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDW
FT                   LSLLNFEVLHASRFHVLPWNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKN
FT                   KPRIRQAVGATRQCRKPQA"
     MMKPARVPQT VVAPDCWGDL PWGELYRKAL ERQLNPWFTK MYGFHLLKIG NLSAEINCEA        60
     CAVSHQVNVS AQGMPVQVQA DPLHLPFADK SVDVCLLAHT LPWCTDPHRL LREADRVLID       120
     DGWLVISGFN PISLMGLRKL VPVLRKTSPY NSRMFTLMRQ LDWLSLLNFE VLHASRFHVL       180
     PWNKHGGKLL NAHIPALGCL QLIVARKRTI PLTLNPMKQS KNKPRIRQAV GATRQCRKPQ       240
     A                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page