(data stored in ACNUC7421 zone)

EMBL: CP000247.PE221

CP000247.PE221       Location/Qualifiers
FT   CDS             complement(242751..243251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68261"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A188"
FT                   /protein_id="ABG68261.1"
FT                   /translation="MRLRRITMANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQ
FT                   IMVTSLSHGLSRAQNVNHQELTITKPVDKSSPLLGKAISENECLTCDFVFYRTNRFGIN
FT                   EPYYKLKLANARLSNIGLTIPHTINDSPGQAEESVSFTYESINWEHSVAGTSAYSLWSE
FT                   RIF"
     MRLRRITMAN PVYLTLNGEL QGLISSGCSS MPSIGNKAQI AHQDQIMVTS LSHGLSRAQN        60
     VNHQELTITK PVDKSSPLLG KAISENECLT CDFVFYRTNR FGINEPYYKL KLANARLSNI       120
     GLTIPHTIND SPGQAEESVS FTYESINWEH SVAGTSAYSL WSERIF                      166
//

If you have problems or comments...

PBIL Back to PBIL home page