(data stored in ACNUC7421 zone)

EMBL: CP000247.PE224

CP000247.PE224       Location/Qualifiers
FT   CDS             complement(248164..249672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68264"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A160"
FT                   /protein_id="ABG68264.1"
FT                   /translation="MTGWHGLLRRYATPATGRENKNMAMDLRNPDVWLAHLLENLPEDK
FT                   LSAALDDGNADWEFVDSEIVKLGSLAHSQLDIPELQRRGLMLLASETKDFRLLAHLLRT
FT                   LQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATIQ
FT                   RDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTSSARSAAIAPQAT
FT                   TGYVPDMSPHTVAAQPPVAATPIPQVTVESHDDKAWRDTLLKVAAILCERQPESPQGYR
FT                   LRRHALWQTITSTPQAESDGRTPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPY
FT                   WLDGHYLSAQTALRLGYKQVADAIRDEVTDFLARLPALINLLFNDRTPFVSEQTKQWLA
FT                   SSGSVNQTVPVVQTDEELQAAKACFDEYGLEAALRYLENLPEGDPRHQFHRQFFGAQLL
FT                   EEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLTAEQ"
     MTGWHGLLRR YATPATGREN KNMAMDLRNP DVWLAHLLEN LPEDKLSAAL DDGNADWEFV        60
     DSEIVKLGSL AHSQLDIPEL QRRGLMLLAS ETKDFRLLAH LLRTLQHAGD ILLASRMLAQ       120
     YTEHYWTCAA PQNMAHKKRF AAQVIKRFES AVQDFAGNAA TIQRDALLGE LAKLAQCWQA       180
     HNASELAKAT DDLFSLFQRA FRDVAPEMTS SARSAAIAPQ ATTGYVPDMS PHTVAAQPPV       240
     AATPIPQVTV ESHDDKAWRD TLLKVAAILC ERQPESPQGY RLRRHALWQT ITSTPQAESD       300
     GRTPLAAFPV DMMDDYLARL NNADMALWQQ VEKSLLLAPY WLDGHYLSAQ TALRLGYKQV       360
     ADAIRDEVTD FLARLPALIN LLFNDRTPFV SEQTKQWLAS SGSVNQTVPV VQTDEELQAA       420
     KACFDEYGLE AALRYLENLP EGDPRHQFHR QFFGAQLLEE AGMVQLAQQQ YRMLFRTGLH       480
     MMLSEWEPSL LKALEQKLTA EQ                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page